Identification
HMDB Protein ID CDBP01196
Secondary Accession Numbers Not Available
Name 1-phosphatidylinositol-3-phosphate 5-kinase
Description Not Available
Synonyms
  1. FYVE finger-containing phosphoinositide kinase
  2. PIKfyve
  3. PIPkin-III
  4. Phosphatidylinositol-3-phosphate 5-kinase
  5. Phosphatidylinositol-3-phosphate 5-kinase type III
  6. Type III PIP kinase
Gene Name PIKFYVE
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol-3-phosphate on the fifth hydroxyl of the myo- inositol ring, to form phosphatidylinositol-3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV)/ multivesicular bodies (MVB) transport intermediates from early endosomes
GO Classification
Function
adenyl ribonucleotide binding
atp binding
phosphatidylinositol phosphate kinase activity
ion binding
protein binding
cation binding
lipid kinase activity
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
Process
phosphoinositide metabolic process
metabolic process
macromolecule metabolic process
phosphatidylinositol metabolic process
cellular protein metabolic process
intracellular signaling pathway
signaling
signaling pathway
protein metabolic process
organophosphate metabolic process
phospholipid metabolic process
glycerophospholipid metabolic process
Cellular Location
  1. Endosome membrane
Pathways
Gene Properties
Chromosome Location Chromosome:2
Locus 2q34
SNPs PIKFYVE
Gene Sequence
>6297 bp
ATGGCCACAGATGATAAGACGTCCCCAACACTGGACTCTGCTAATGATTTGCCTCGATCT
CCTACTAGTCCTTCTCATCTCACACACTTTAAACCTTTGACTCCTGATCAAGATGAGCCC
CCTTTTAAATCAGCTTATAGTTCTTTTGTAAATCTCTTTCGTTTTAACAAAGAGAGAGCA
GAAGGAGGCCAGGGAGAACAGCAGCCTTTGAGTGGAAGTTGGACCAGCCCTCAGCTCCCT
TCGAGGACACAGTCTGTTAGGTCACCCACACCTTATAAAAAGCAGCTTAATGAGGAACTC
CAGCGGCGCTCTTCAGCATTAGACACAAGAAGGAAAGCAGAACCTACCTTTGGAGGTCAT
GACCCTCGTACAGCTGTTCAGCTTCGAAGCCTCAGCACAGTATTAAAACGCCTCAAGGAA
ATCATGGAGGGGAAAAGCCAGGATAGTGACCTGAAACAATACTGGATGCCAGATAGCCAA
TGTAAAGAGTGCTATGACTGTAGTGAGAAATTTACAACCTTTAGGCGCAGACACCATTGC
CGACTATGTGGGCAGATTTTCTGCAGTCGTTGCTGTAATCAAGAAATCCCTGGAAAATTT
ATGGGCTATACAGGAGACCTCCGAGCTTGCACATATTGTAGAAAAATAGCCTTAAGTTAT
GCTCATTCCACAGACAGTAATTCTATTGGGGAAGACTTGAATGCTCTTTCAGATTCTGCT
TGCTCTGTGTCTGTGCTTGATCCAAGTGAACCCCGAACACCTGTTGGGAGTAGGAAAGCC
AGCCGTAACATATTTTTAGAGGATGATTTGGCCTGGCAAAGTTTGATTCATCCAGATTCC
TCAAATACTCCTCTTTCAACAAGACTTGTATCTGTGCAAGAGGATGCTGGGAAATCTCCT
GCTCGAAATAGATCAGCCAGCATTACTAACCTGTCACTGGATAGATCTGGTTCTCCTATG
GTACCTTCATATGAGACATCTGTCAGTCCCCAGGCTAACCGAACATATGTTAGGACAGAG
ACCACTGAGGATGAACGCAAAATTCTTCTGGACAGTGTGCAGTTAAAAGACCTGTGGAAA
AAAATCTGCCATCACAGCAGTGGAATGGAGTTTCAGGATCACCGCTACTGGTTGAGAACG
CATCCCAACTGCATTGTAGGAAAGGAATTAGTCAACTGGCTAATCCGAAATGGGCATATT
GCCACAAGGGCACAAGCTATAGCAATTGGACAAGCAATGGTTGATGGACGTTGGCTGGAT
TGTGTTAGTCATCACGACCAGCTTTTCAGAGATGAGTATGCGCTGTATAGACCACTGCAG
AGTACAGAATTTTCTGAGACGCCTTCTCCCGACAGTGACTCAGTGAACTCCGTGGAAGGA
CACTCTGAGCCATCCTGGTTTAAAGACATAAAGTTTGATGACAGTGACACAGAACAGATA
GCTGAAGAAGGTGACGATAATTTGGCTAATTCTGCCAGTCCTAGCAAGCGCACATCAGTC
AGCAGTTTCCAGTCCACAGTGGACAGTGACTCAGCCGCTTCTATCAGCCTGAACGTGGAG
CTGGACAACGTGAACTTCCATATCAAGAAGCCCTCCAAGTACCCACATGTGCCCCCTCAC
CCTGCTGACCAAAAAGAGTATTTGATTTCTGACACTGGAGGACAACAGCTCTCAATAAGT
GACGCTTTCATCAAAGAATCCTTATTTAATCGCCGAGTAGAGGAAAAATCCAAAGAGCTG
CCTTTCACACCTTTGGGCTGGCATCATAACAACCTGGAGCTCCTGAGGGAGGAGAATGGG
GAGAAACAAGCCATGGAGAGGTTGCTTTCAGCTAATCATAACCACATGATGGCACTACTC
CAGCAGTTGCTCCATAGTGACTCACTGTCATCATCTTGGAGGGACATCATCGTGTCATTG
GTCTGCCAGGTTGTTCAGACAGTCCGACCTGATGTCAAGAACCAGGATGATGACATGGAT
ATCCGTCAGTTTGTCCACATCAAAAAAATCCCAGGTGGAAAGAAGTTTGATTCTGTGGTT
GTCAATGGCTTTGTTTGTACCAAGAACATTGCACATAAAAAGATGAGTTCTTGTATTAAA
AACCCCAAAATTCTTCTGTTGAAGTGTTCCATTGAGTATCTCTACAGAGAAGAAACTAAG
TTTACTTGCATTGATCCTATTGTGCTTCAGGAAAGGGAATTCTTGAAGAATTATGTCCAG
CGAATAGTTGATGTTCGACCCACCTTGGTTCTTGTTGAGAAAACAGTGTCTCGGATTGCC
CAGGACATGTTATTGGAACATGGCATTACTTTGGTCATTAATGTAAAGTCACAAGTTTTG
GAACGAATCAGTCGAATGACCCAAGGTGATTTAGTGATGTCAATGGACCAGCTGCTTACG
AAACCACACCTGGGCACTTGTCACAAATTTTATATGCAGATATTTCAGTTGCCTAATGAA
CAAACCAAGACACTGATGTTTTTTGAAGGTTGTCCACAGCACCTAGGCTGTACAATCAAG
CTAAGAGGAGGCTCTGATTATGAGCTGGCTCGAGTTAAGGAGATCCTAATATTTATGATC
TGTGTTGCTTATCATTCTCAACTAGAAATATCCTTTCTCATGGATGAATTTGCTATGCCT
CCCACATTAATGCAAAACCCTTCATTCCATTCCCTGATTGAGGGACGAGGGCATGAGGGG
GCTGTCCAAGAGCAGTACGGTGGAGGTTCCATCCCCTGGGATCCTGACATCCCTCCTGAG
TCTCTGCCCTGTGATGATAGCAGTTTGCTGGAATTGAGGATTGTGTTTGAGAAGGGTGAG
CAGGAAAATAAAAATCTTCCGCAGGCTGTTGCCTCTGTGAAGCATCAAGAACATAGCACA
ACAGCTTGCCCGGCGGGTCTCCCTTGTGCTTTCTTTGCACCTGTACCGGAATCATTGTTG
CCACTCCCTGTGGATGACCAACAAGATGCTTTAGGCAGCGAGCAGCCAGAGACTTTGCAG
CAAACAGTTGTGCTGCAGGATCCCAAAAGCCAGATAAGAGCCTTTAGAGACCCTCTACAG
GATGACACTGGATTATATGTTACTGAGGAAGTCACCTCCTCTGAAGATAAACGAAAGACT
TATTCTTTGGCCTTTAAGCAGGAATTAAAAGATGTGATCCTCTGTATCTCCCCAGTAATC
ACATTCCGAGAACCCTTTCTTTTAACTGAAAAGGGGATGAGATGCTCTACCCGAGATTAT
TTTGCAGAGCAGGTTTACTGGTCTCCTCTCCTCAATAAAGAATTCAAAGAAATGGAGAAC
AGGAGGAAGAAACAGCTGCTCAGGGATCTCTCTGGACTTCAGGGCATGAATGGAAGTATT
CAGGCCAAGTCTATTCAAGTCTTACCCTCACATGAGCTAGTGAGCACTAGAATTGCTGAG
CATCTGGGCGATAGCCAGAGCTTGGGTAGAATGCTGGCCGATTATCGAGCCAGAGGAGGA
AGAATTCAGCCCAAAAATTCAGACCCTTTTGCTCATTCAAAGGATGCATCAAGTACTTCA
AGTGGCCAATCAGGAAGCAAAAATGAGGGTGATGAAGAGAGAGGGCTTATTCTGAGTGAT
GCTGTGTGGTCAACAAAGGTGGACTGTCTGAATCCCATTAATCACCAGAGACTTTGTGTG
CTCTTCAGCAGCTCTTCTGCCCAGTCCAGCAATGCTCCTAGTGCCTGTGTCAGTCCTTGG
ATTGTAACAATGGAATTTTATGGAAAGAATGATCTTACATTAGGAATATTTTTAGAGAGA
TACTGTTTCAGGCCTTCTTATCAGTGTCCAAGCATGTTCTGTGATACCCCCATGGTACAT
CATATTCGGCGCTTTGTTCATGGCCAAGGCTGTGTGCAGATAATCCTGAAGGAGTTGGAT
TCTCCAGTACCTGGATATCAGCATACAATTCTTACATATTCCTGGTGTAGAATCTGCAAA
CAGGTAACACCAGTTGTTGCTCTTTCCAATGAGTCCTGGTCTATGTCATTTGCAAAATAC
CTTGAACTTAGGTTTTATGGGCACCAGTATACTCGCAGAGCCAACGCTGAGCCCTGTGGT
CACTCCATCCATCATGATTATCACCAGTATTTCTCCTATAACCAGATGGTGGCGTCTTTC
AGTTATTCTCCCATTCGGCTTCTTGAAGTATGTGTTCCACTCCCCAAAATATTCATTAAG
CGTCAGGCCCCATTAAAAGTGTCCCTTCTTCAGGATCTGAAGGACTTCTTTCAAAAAGTT
TCACAGGTATATGTTGCCATTGATGAAAGACTTGCATCTTTGAAAACTGATACATTTAGT
AAAACAAGAGAGGAAAAAATGGAAGATATTTTTGCACAGAAAGAGATGGAAGAAGGTGAG
TTCAAGAACTGGATTGAGAAGATGCAAGCAAGGCTCATGTCTTCCTCTGTAGATACCCCT
CAGCAACTGCAGTCGGTCTTTGAGTCACTCATTGCCAAGAAACAAAGTCTCTGTGAAGTG
CTGCAAGCTTGGAATAACAGGTTGCAGGACCTTTTCCAACAGGAAAAGGGTAGAAAGAGA
CCTTCAGTTCCTCCAAGTCCTGGAAGACTGAGACAAGGGGAAGAAAGCAAGATAAGTGCG
ATGGATGCATCTCCACGGAATATTTCTCCAGGACTTCAGAATGGAGAAAAAGAGGATCGC
TTCTTAACAACTTTGTCCAGCCAGAGCTCCACCAGTTCTACTCATCTCCAATTGCCTACG
CCACCTGAAGTCATGTCTGAACAGTCAGTGGGAGGGCCCCCTGAGCTAGATACAGCCAGC
AGTTCCGAAGATGTGTTTGATGGGCATTTGCTGGGATCCACAGACAGCCAAGTGAAGGAA
AAGTCAACCATGAAAGCCATCTTTGCAAATTTGCTTCCAGGAAATAGCTATAATCCTATT
CCATTTCCTTTTGATCCAGATAAACACTACTTAATGTATGAACATGAACGAGTGCCCATT
GCAGTCTGCGAGAAGGAACCCAGCTCCATCATTGCTTTTGCTCTCAGTTGTAAAGAATAC
CGAAATGCCTTAGAGGAATTGTCTAAAGCGACTCAGTGGAACAGTGCCGAAGAAGGGCTT
CCAACAAATAGTACTTCAGATAGCAGACCAAAGAGTAGCAGCCCTATCAGATTACCTGAA
ATGAGTGGAGGACAGACAAATCGTACAACAGAAACAGAACCACAACCAACCAAAAAGGCT
TCTGGAATGTTGTCCTTCTTCAGAGGGACAGCAGGGAAAAGCCCCGATCTCTCTTCCCAG
AAGAGAGAGACCTTACGTGGAGCAGATAGTGCTTACTACCAGGTTGGGCAGACGGGCAAG
GAGGGGACCGAGAATCAAGGCGTTGAGCCTCAAGATGAAGTAGATGGAGGAGATACACAA
AAGAAGCAACTCATAAATCCTCATGTGGAACTTCAATTTTCAGATGCTAATGCCAAGTTT
TACTGTCGGCTCTACTATGCGGGAGAGTTTCATAAGATGCGTGAAGTGATTCTGGACAGC
AGTGAAGAAGATTTCATTCGTTCCCTCTCCCACTCATCACCCTGGCAGGCCCGGGGAGGC
AAATCAGGAGCTGCCTTCTATGCAACTGAGGATGATAGATTTATTTTGAAGCAAATGCCT
CGTCTGGAAGTCCAGTCCTTCCTCGACTTTGCACCACATTACTTCAATTATATTACAAAT
GCTGTTCAACAAAAGAGGCCCACGGCGTTGGCCAAAATTCTTGGAGTTTACAGAATTGGT
TATAAGAACTCTCAGAACAACACTGAGAAGAAGTTAGATCTCCTTGTCATGGAAAATCTT
TTCTACGGGAGAAAGATGGCACAGGTTTTTGATTTGAAGGGCTCTCTTAGGAATCGGAAT
GTAAAAACTGACACTGGAAAAGAGAGTTGTGATGTGGTCCTGCTAGATGAAAATCTCCTA
AAGATGGTTCGAGACAACCCTCTATATATTCGTTCTCATTCCAAAGCTGTGCTGAGAACC
TCGATCCATAGTGACTCCCATTTCCTTTCTAGCCACCTCATTATAGATTATTCTTTGCTG
GTTGGGCGAGATGATACTAGCAATGAGCTAGTAGTTGGAATTATAGATTATATTCGAACA
TTTACATGGGACAAAAAGCTTGAGATGGTTGTGAAATCAACAGGAATTTTAGGTGGACAA
GGTAAAATGCCAACAGTGGTGTCTCCGGAGTTGTACAGGACTAGGTTTTGTGAGGCAATG
GACAAGTATTTCCTAATGGTACCAGACCACTGGACAGGCTTGGGTCTGAATTGCTGA
Protein Properties
Number of Residues 2098
Molecular Weight 237134.1
Theoretical pI 6.67
Pfam Domain Function
Signals
  • ["None"]
Transmembrane Regions
  • ["None"]
Protein Sequence
>1-phosphatidylinositol-3-phosphate 5-kinase
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERA
EGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGH
DPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHC
RLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSA
CSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWK
KICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQI
AEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPH
PADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENG
EKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMD
IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIKNPKILLLKCSIEYLYREETK
FTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVL
ERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEG
AVQEQYGGGSIPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHST
TACPAGLPCAFFAPVPESLLPLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQ
DDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDY
FAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKSIQVLPSHELVSTRIAE
HLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEGDEERGLILSD
AVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLER
YCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICK
QVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASF
SYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFS
KTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCEV
LQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGEKEDR
FLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHLLGSTDSQVKE
KSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEY
RNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKA
SGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQ
KKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGG
KSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIG
YKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLL
KMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRT
FTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC
GenBank ID Protein 121583483
UniProtKB/Swiss-Prot ID Q9Y2I7
UniProtKB/Swiss-Prot Entry Name FYV1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015040.3
GeneCard ID PIKFYVE
GenAtlas ID PIKFYVE
HGNC ID HGNC:23785
References
General References Not Available