| Identification |
|---|
| HMDB Protein ID
| CDBP05651 |
| Secondary Accession Numbers
| Not Available |
| Name
| Taste receptor type 2 member 46 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| TAS2R46 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| G protein-coupled receptor activity |
| Specific Function
| Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency (By similarity). |
| GO Classification
|
| Biological Process |
| G-protein coupled receptor signaling pathway |
| detection of chemical stimulus involved in sensory perception of bitter taste |
| Cellular Component |
| plasma membrane |
| integral to membrane |
| ciliary membrane |
| Molecular Function |
| bitter taste receptor activity |
| G protein-coupled receptor activity |
|
| Cellular Location
|
- Membrane
- Cell projection
- cilium membrane
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12p13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 309 |
| Molecular Weight
| 35522.27 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
- ["2-22", "47-67", "87-107", "127-147", "179-199", "230-250", "260-280"]
|
| Protein Sequence
|
>Taste receptor type 2 member 46
MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
VLVLNWYATELNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT
ILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI
YFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYW
VKGEKPSSS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P59540 |
| UniProtKB/Swiss-Prot Entry Name
| T2R46_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18877 |
| References |
|---|
| General References
| Not Available |