Identification
HMDB Protein ID CDBP05642
Secondary Accession Numbers Not Available
Name Oxysterols receptor LXR-alpha
Description Not Available
Synonyms Not Available
Gene Name NR1H3
Protein Type Receptor
Biological Properties
General Function zinc ion binding
Specific Function Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity (PubMed:19481530, PubMed:25661920). Interaction with retinoic acid receptor (RXR) shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES (By similarity). LXRES are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides (By similarity). Plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8 (PubMed:19481530). Interplays functionally with RORA for the regulation of genes involved in liver metabolism (By similarity).
GO Classification
Biological Process
positive regulation of toll-like receptor 4 signaling pathway
cellular response to lipopolysaccharide
regulation of circadian rhythm
positive regulation of cellular protein metabolic process
triglyceride homeostasis
positive regulation of transcription, DNA-dependent
negative regulation of cholesterol storage
negative regulation of transcription from RNA polymerase II promoter
negative regulation of cold-induced thermogenesis
positive regulation of transcription from RNA polymerase II promoter
negative regulation of interferon-gamma-mediated signaling pathway
cell differentiation
negative regulation of lipid transport
regulation of nuclear receptor transcription coactivator activity
positive regulation of lipoprotein lipase activity
negative regulation of macrophage derived foam cell differentiation
sterol homeostasis
positive regulation of triglyceride biosynthetic process
negative regulation of pinocytosis
cholesterol homeostasis
positive regulation of fatty acid biosynthetic process
positive regulation of cholesterol efflux
multicellular organismal development
lipid homeostasis
response to progesterone stimulus
lipid metabolic process
negative regulation of macrophage activation
negative regulation of inflammatory response
apoptotic cell clearance
negative regulation of pancreatic juice secretion
positive regulation of cholesterol transport
transcription initiation from RNA polymerase II promoter
negative regulation of secretion of lysosomal enzymes
response to lipid
positive regulation of receptor biosynthetic process
Cellular Component
nucleus
nucleoplasm
nuclear chromatin
receptor complex
host cell nucleus
RNA polymerase II transcription factor complex
cytoplasm
Molecular Function
nuclear receptor activity
steroid hormone receptor activity
transcription regulatory region sequence-specific DNA binding
cholesterol binding
transcription factor binding
zinc ion binding
transcription coactivator activity
ligand-dependent nuclear receptor transcription coactivator activity
transcription regulatory region DNA binding
DNA binding
signaling receptor activity
sterol response element binding
DNA-binding transcription factor activity, RNA polymerase II-specific
RNA polymerase II regulatory region sequence-specific DNA binding
ligand-activated transcription factor activity
Cellular Location
  1. Nucleus
  2. Cytoplasm
Pathways
Gene Properties
Chromosome Location 11
Locus 11p11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 387
Molecular Weight 50395.34
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Oxysterols receptor LXR-alpha
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13133
UniProtKB/Swiss-Prot Entry Name NR1H3_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7966
References
General References Not Available