Identification
HMDB Protein ID CDBP05638
Secondary Accession Numbers Not Available
Name C-C motif chemokine 3
Description Not Available
Synonyms Not Available
Gene Name CCL3
Protein Type Enzyme
Biological Properties
General Function protein kinase activity
Specific Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
GO Classification
Biological Process
positive regulation of gene expression
positive regulation of calcium ion import
positive regulation of ERK1 and ERK2 cascade
chemokine-mediated signaling pathway
regulation of sensory perception of pain
positive regulation of GTPase activity
osteoblast differentiation
positive regulation of calcium-mediated signaling
positive regulation of interleukin-1 beta secretion
cellular response to organic cyclic compound
exocytosis
positive regulation of microglial cell activation
calcium ion transport
cell-cell signaling
regulation of cell shape
negative regulation of gene expression
positive regulation of microglial cell migration
cellular calcium ion homeostasis
positive regulation of cell migration
positive regulation of neuron apoptotic process
positive regulation of natural killer cell chemotaxis
negative regulation by host of viral transcription
calcium-mediated signaling
cellular response to interferon-gamma
positive regulation of tumor necrosis factor production
positive regulation of protein kinase B signaling cascade
positive regulation of inflammatory response
regulation of behavior
positive regulation of calcium ion transport
cell activation
chemotaxis
release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
response to cholesterol
eosinophil chemotaxis
G-protein coupled receptor signaling pathway
signaling
MAPK cascade
eosinophil degranulation
inflammatory response
T cell chemotaxis
monocyte chemotaxis
cellular response to tumor necrosis factor
cytokine-mediated signaling pathway
granulocyte chemotaxis
protein kinase B signaling cascade
astrocyte cell migration
lymphocyte chemotaxis
cytoskeleton organization
negative regulation of osteoclast differentiation
macrophage chemotaxis
neutrophil chemotaxis
response to toxin
negative regulation of bone mineralization
cellular response to interleukin-1
lipopolysaccharide-mediated signaling pathway
Cellular Component
cell
cytosol
cytoplasm
extracellular region
extracellular space
Molecular Function
calcium-dependent protein kinase C activity
CCR chemokine receptor binding
CCR1 chemokine receptor binding
CCR5 chemokine receptor binding
phospholipase activator activity
kinase activity
chemoattractant activity
protein kinase activity
identical protein binding
chemokine activity
Cellular Location
  1. Secreted
Pathways
Gene Properties
Chromosome Location 17
Locus 17q12
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 92
Molecular Weight 10085.355
Theoretical pI Not Available
Pfam Domain Function
Signals
  • ["1-23"]
Transmembrane Regions Not Available
Protein Sequence
>C-C motif chemokine 3
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P10147
UniProtKB/Swiss-Prot Entry Name CCL3_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10627
References
General References Not Available