| Identification |
|---|
| HMDB Protein ID
| CDBP05634 |
| Secondary Accession Numbers
| Not Available |
| Name
| Beclin-1 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| BECN1 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| ubiquitin protein ligase binding |
| Specific Function
| Plays a central role in autophagy (PubMed:23184933, PubMed:28445460). Acts as core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2 (PubMed:20643123, PubMed:20208530, PubMed:26783301). Essential for the formation of PI3KC3-C2 but not PI3KC3-C1 PI3K complex forms. Involved in endocytosis (PubMed:25275521). Protects against infection by a neurovirulent strain of Sindbis virus (PubMed:9765397). May play a role in antiviral host defense.Beclin-1-C 35 kDa localized to mitochondria can promote apoptosis; it induces the mitochondrial translocation of BAX and the release of proapoptotic factors. |
| GO Classification
|
| Biological Process |
| defense response to virus |
| late endosome to vacuole transport |
| regulation of cytokinesis |
| mitophagy |
| viral reproduction |
| mitotic metaphase plate congression |
| positive regulation of phosphatidylinositol 3-kinase cascade |
| negative regulation of cell death |
| autophagosome assembly |
| endocytosis |
| positive regulation of attachment of mitotic spindle microtubules to kinetochore |
| autophagy of mitochondrion |
| autophagy |
| protein deubiquitination |
| cellular response to nitrogen starvation |
| response to mitochondrial depolarisation |
| macroautophagy |
| receptor catabolic process |
| cell division |
| cellular response to glucose starvation |
| apoptotic process |
| negative regulation of apoptotic process |
| cellular defense response |
| positive regulation of intrinsic apoptotic signaling pathway |
| early endosome to late endosome transport |
| Cellular Component |
| cell |
| autophagosome |
| endoplasmic reticulum membrane |
| cytosol |
| mitochondrial membrane |
| phagophore assembly site |
| endoplasmic reticulum |
| phosphatidylinositol 3-kinase complex, class III |
| phosphatidylinositol 3-kinase complex, class III, type I |
| Golgi apparatus |
| phosphatidylinositol 3-kinase complex, class III, type II |
| nucleus |
| extrinsic to membrane |
| endosome membrane |
| endosome |
| Molecular Function |
| ubiquitin protein ligase binding |
| GTPase binding |
| phosphatidylinositol 3-kinase binding |
| protein kinase binding |
|
| Cellular Location
|
- Nucleus
- Cytoplasm
- Mitochondrion
- Endosome membrane
- Cytoplasmic vesicle
- Endoplasmic reticulum membrane
- Mitochondrion membrane
- Golgi apparatus
- trans-Golgi network membrane
- Endosome
- Autophagosome
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q21.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 450 |
| Molecular Weight
| 51895.945 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Beclin-1
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q14457 |
| UniProtKB/Swiss-Prot Entry Name
| BECN1_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:1034 |
| References |
|---|
| General References
| Not Available |