Identification
HMDB Protein ID CDBP05632
Secondary Accession Numbers Not Available
Name Oxysterols receptor LXR-beta
Description Not Available
Synonyms Not Available
Gene Name NR1H2
Protein Type Receptor
Biological Properties
General Function zinc ion binding
Specific Function Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity (PubMed:25661920). Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8; DLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism (By similarity). Plays an anti-inflammatory role during the hepatic acute phase response by acting as a corepressor: inhibits the hepatic acute phase response by preventing dissociation of the N-Cor corepressor complex (PubMed:20159957).
GO Classification
Biological Process
positive regulation of lipid storage
negative regulation of transcription, DNA-dependent
positive regulation of transcription, DNA-dependent
negative regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase II promoter
cell differentiation
negative regulation of cholesterol storage
positive regulation of lipoprotein lipase activity
negative regulation of cold-induced thermogenesis
positive regulation of triglyceride biosynthetic process
negative regulation of interferon-gamma-mediated signaling pathway
cholesterol homeostasis
negative regulation of lipid transport
positive regulation of cholesterol efflux
negative regulation of macrophage derived foam cell differentiation
lipid homeostasis
negative regulation of pinocytosis
cellular lipid metabolic process
negative regulation of proteolysis
multicellular organismal development
lipid metabolic process
positive regulation of fatty acid biosynthetic process
positive regulation of cholesterol transport
retinoic acid receptor signaling pathway
positive regulation of high-density lipoprotein particle assembly
response to lipid
cellular response to lipopolysaccharide
transcription initiation from RNA polymerase II promoter
positive regulation of pancreatic juice secretion
positive regulation of cellular protein metabolic process
positive regulation of secretion of lysosomal enzymes
Cellular Component
nucleus
nucleoplasm
nuclear chromatin
host cell nucleus
RNA polymerase II transcription factor complex
cytoplasm
Molecular Function
apolipoprotein A-I receptor binding
ligand-activated transcription factor activity
nuclear receptor activity
steroid hormone receptor activity
ATPase binding
transcription regulatory region sequence-specific DNA binding
transcription factor binding
zinc ion binding
ligand-dependent nuclear receptor transcription coactivator activity
RNA polymerase II core promoter proximal region sequence-specific DNA binding
retinoid X receptor binding
DNA binding
signaling receptor activity
DNA-binding transcription activator activity, RNA polymerase II-specific
DNA-binding transcription factor activity, RNA polymerase II-specific
RNA polymerase II regulatory region sequence-specific DNA binding
Cellular Location
  1. Nucleus
Pathways
Gene Properties
Chromosome Location 19
Locus 19q13.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 364
Molecular Weight 50973.375
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Oxysterols receptor LXR-beta
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P55055
UniProtKB/Swiss-Prot Entry Name NR1H2_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7965
References
General References Not Available