| Identification |
|---|
| HMDB Protein ID
| CDBP05621 |
| Secondary Accession Numbers
| Not Available |
| Name
| Suppressor of cytokine signaling 3 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| SOCS3 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| protein kinase inhibitor activity |
| Specific Function
| SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo (By similarity). Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST (By similarity). |
| GO Classification
|
| Biological Process |
| receptor signaling pathway via JAK-STAT |
| negative regulation of apoptotic process |
| branching involved in labyrinthine layer morphogenesis |
| negative regulation of inflammatory response |
| cellular response to leukemia inhibitory factor |
| negative regulation of insulin receptor signaling pathway |
| interleukin-6-mediated signaling pathway |
| post-translational protein modification |
| negative regulation of receptor signaling pathway via JAK-STAT |
| regulation of interferon-gamma-mediated signaling pathway |
| negative regulation of tyrosine phosphorylation of STAT protein |
| phosphatidylinositol phosphorylation |
| placenta blood vessel development |
| cytokine-mediated signaling pathway |
| positive regulation of cell differentiation |
| regulation of growth |
| positive regulation of tyrosine phosphorylation of STAT protein |
| intracellular signal transduction |
| spongiotrophoblast differentiation |
| trophoblast giant cell differentiation |
| protein ubiquitination |
| Cellular Component |
| cytosol |
| phosphatidylinositol 3-kinase complex |
| Molecular Function |
| phosphotyrosine binding |
| protein kinase inhibitor activity |
| 1-phosphatidylinositol-3-kinase regulator activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q25.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 225 |
| Molecular Weight
| 24769.88 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Suppressor of cytokine signaling 3
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O14543 |
| UniProtKB/Swiss-Prot Entry Name
| SOCS3_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:19391 |
| References |
|---|
| General References
| Not Available |