Identification
HMDB Protein ID CDBP05619
Secondary Accession Numbers Not Available
Name Dickkopf-related protein 1
Description Not Available
Synonyms Not Available
Gene Name DKK1
Protein Type Enzyme
Biological Properties
General Function receptor antagonist activity
Specific Function Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6 (PubMed:22000856). DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (PubMed:17143291). Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity (By similarity).
GO Classification
Biological Process
positive regulation of Wnt signaling pathway, calcium modulating pathway
negative regulation of ossification
positive regulation of Wnt signaling pathway, planar cell polarity pathway
positive regulation of JUN kinase activity
regulation of dopaminergic neuron differentiation
cell morphogenesis involved in differentiation
negative regulation of protein binding
endoderm formation
regulation of receptor internalization
embryonic limb morphogenesis
positive regulation of gene expression
regulation of synaptic transmission, glutamatergic
modulation of age-related behavioral decline
regulation of endodermal cell fate specification
synapse pruning
learning or memory
motor learning
forebrain development
Wnt signaling pathway involved in somitogenesis
positive regulation of cell death
negative regulation of BMP signaling pathway
hair follicle development
response to retinoic acid
negative regulation of canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment
negative regulation of peptidyl-serine phosphorylation
negative regulation of apoptotic process
negative regulation of cardiac muscle cell differentiation
face morphogenesis
negative regulation of mesodermal cell fate specification
limb development
negative regulation of pathway-restricted SMAD protein phosphorylation
negative regulation of transcription from RNA polymerase II promoter
negative regulation of presynapse assembly
negative regulation of Wnt receptor signaling pathway
negative regulation of Wnt-Frizzled-LRP5/6 complex assembly
mesoderm formation
positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway
negative regulation of canonical Wnt receptor signaling pathway
positive regulation of midbrain dopaminergic neuron differentiation
positive regulation of tau-protein kinase activity
positive regulation of neuron death
negative regulation of neuron projection development
Cellular Component
plasma membrane
early endosome membrane
extracellular region
extracellular space
Molecular Function
co-receptor binding
low-density lipoprotein particle receptor binding
receptor antagonist activity
growth factor activity
Cellular Location
  1. Secreted
Pathways
Gene Properties
Chromosome Location 10
Locus 10q21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 266
Molecular Weight 28671.305
Theoretical pI Not Available
Pfam Domain Function
Signals
  • ["1-31"]
Transmembrane Regions Not Available
Protein Sequence
>Dickkopf-related protein 1
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR
CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG
EGLSCRIQKDHHQASNSSRLHTCQRH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O94907
UniProtKB/Swiss-Prot Entry Name DKK1_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2891
References
General References Not Available