| Identification |
|---|
| HMDB Protein ID
| CDBP05616 |
| Secondary Accession Numbers
| Not Available |
| Name
| Suppressor of cytokine signaling 5 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| SOCS5 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| receptor tyrosine kinase binding |
| Specific Function
| SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Inhibits for instance EGF signaling by mediating the degradation of the EGF receptor/EGFR. Involved in the regulation of T-helper cell differentiation by inhibiting of the IL4 signaling pathway which promotes differentiation into the Th2 phenotype. Can also partially inhibit IL6 and LIF signaling. |
| GO Classification
|
| Biological Process |
| epidermal growth factor receptor signaling pathway |
| intracellular signal transduction |
| protein ubiquitination |
| positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| cellular response to low-density lipoprotein particle stimulus |
| negative regulation of inflammatory response |
| negative regulation of epidermal growth factor-activated receptor activity |
| negative regulation of monocyte chemotactic protein-1 production |
| negative regulation of T-helper 2 cell differentiation |
| post-translational protein modification |
| positive regulation of T-helper 1 cell differentiation |
| phosphatidylinositol phosphorylation |
| receptor signaling pathway via JAK-STAT |
| cytokine-mediated signaling pathway |
| vascular endothelial cell response to fluid shear stress |
| negative regulation of interleukin-6 production |
| negative regulation of signal transduction |
| regulation of growth |
| Cellular Component |
| cytosol |
| phosphatidylinositol 3-kinase complex |
| Molecular Function |
| 1-phosphatidylinositol-3-kinase regulator activity |
| epidermal growth factor receptor binding |
| receptor tyrosine kinase binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2p21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 536 |
| Molecular Weight
| 61245.525 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Suppressor of cytokine signaling 5
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O75159 |
| UniProtKB/Swiss-Prot Entry Name
| SOCS5_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16852 |
| References |
|---|
| General References
| Not Available |