Identification
HMDB Protein ID CDBP05613
Secondary Accession Numbers Not Available
Name Caspase-3
Description Not Available
Synonyms Not Available
Gene Name CASP3
Protein Type Enzyme
Biological Properties
General Function protein-containing complex binding
Specific Function Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage.
GO Classification
Biological Process
wound healing
response to cobalt ion
positive regulation of amyloid-beta formation
response to X-ray
learning or memory
nerve growth factor receptor signaling pathway
protein processing
response to glucocorticoid stimulus
apoptotic signaling pathway
regulation of macroautophagy
response to UV
keratinocyte differentiation
striated muscle cell differentiation
response to tumor necrosis factor
anterior neural tube closure
response to amino acid stimulus
erythrocyte differentiation
apoptotic process
cell fate commitment
proteolysis
axonal fasciculation
neuron apoptotic process
response to glucose stimulus
B cell homeostasis
negative regulation of apoptotic process
cytokine-mediated signaling pathway
cellular response to staurosporine
hippocampus development
T cell homeostasis
execution phase of apoptosis
response to lipopolysaccharide
negative regulation of B cell proliferation
extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of activated T cell proliferation
neuron differentiation
glial cell apoptotic process
response to DNA damage stimulus
response to estradiol stimulus
hippo signaling
response to nicotine
response to hydrogen peroxide
intrinsic apoptotic signaling pathway in response to osmotic stress
heart development
sensory perception of sound
response to hypoxia
leukocyte apoptotic process
luteolysis
apoptotic DNA fragmentation
positive regulation of neuron apoptotic process
platelet formation
regulation of protein stability
Cellular Component
cytosol
membrane raft
cytoplasm
nucleus
nucleoplasm
neuronal cell body
death-inducing signaling complex
Molecular Function
death receptor binding
phospholipase A2 activator activity
protease binding
protein-containing complex binding
peptidase activity
aspartic-type endopeptidase activity
cyclin-dependent protein kinase inhibitor activity
cysteine-type endopeptidase activity
cysteine-type endopeptidase activity involved in apoptotic process
cysteine-type endopeptidase activity involved in apoptotic signaling pathway
cysteine-type endopeptidase activity involved in execution phase of apoptosis
Cellular Location
  1. Cytoplasm
Pathways
Gene Properties
Chromosome Location 4
Locus 4q35.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 277
Molecular Weight 31607.58
Theoretical pI Not Available
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Caspase-3
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P42574
UniProtKB/Swiss-Prot Entry Name CASP3_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:1504
References
General References Not Available