| Identification |
|---|
| HMDB Protein ID
| CDBP05611 |
| Secondary Accession Numbers
| Not Available |
| Name
| Growth-regulated alpha protein |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| CXCL1 |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| signaling receptor binding |
| Specific Function
| Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
| GO Classification
|
| Biological Process |
| actin cytoskeleton organization |
| killing of cells of other organism |
| immune response |
| leukocyte chemotaxis |
| cytokine-mediated signaling pathway |
| neutrophil degranulation |
| negative regulation of cell proliferation |
| intracellular signal transduction |
| signal transduction |
| chemotaxis |
| G-protein coupled receptor signaling pathway |
| inflammatory response |
| neutrophil chemotaxis |
| cellular response to lipopolysaccharide |
| antimicrobial humoral immune response mediated by antimicrobial peptide |
| nervous system development |
| chemokine-mediated signaling pathway |
| Cellular Component |
| extracellular region |
| extracellular space |
| specific granule lumen |
| tertiary granule lumen |
| Molecular Function |
| growth factor activity |
| enzyme activator activity |
| receptor binding |
| chemokine activity |
| CXCR chemokine receptor binding |
|
| Cellular Location
|
- Secreted
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4q13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 107 |
| Molecular Weight
| 11301.27 |
| Theoretical pI
| Not Available |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Growth-regulated alpha protein
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P09341 |
| UniProtKB/Swiss-Prot Entry Name
| GROA_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4602 |
| References |
|---|
| General References
| Not Available |