| Identification |
|---|
| HMDB Protein ID
| CDBP05569 |
| Secondary Accession Numbers
| Not Available |
| Name
| Palmitoyltransferase ZDHHC17 |
| Description
| Not Available |
| Synonyms
|
- Huntingtin yeast partner H
- Huntingtin-interacting protein 14
- Huntingtin-interacting protein 3
- Huntingtin-interacting protein H
- Putative MAPK-activating protein PM11
- Putative NF-kappa-B-activating protein 205
- Zinc finger DHHC domain-containing protein 17
- HIP-14
- HIP-3
- DHHC-17
|
| Gene Name
| ZDHHC17 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. Palmitoylates MPP1 in erythrocytes. May be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. Has transforming activity. Mediates Mg(2+) transport.
|
| GO Classification
|
| Biological Process |
| positive regulation of I-kappaB kinase/NF-kappaB cascade |
| protein palmitoylation |
| lipoprotein transport |
| Cellular Component |
| Golgi-associated vesicle membrane |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| signal transducer activity |
| magnesium ion transmembrane transporter activity |
| protein-cysteine S-palmitoleyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12q21.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 72639.345 |
| Theoretical pI
| 7.497 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|103471993|ref|NP_056151.2| palmitoyltransferase ZDHHC17 [Homo sapiens]
MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD
IVKATQYGIY
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IUH5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18412 |
| References |
|---|
| General References
| Not Available |