Showing Protein Xyloside xylosyltransferase 1 (CDBP05560)
Identification | ||||||
---|---|---|---|---|---|---|
HMDB Protein ID | CDBP05560 | |||||
Secondary Accession Numbers | Not Available | |||||
Name | Xyloside xylosyltransferase 1 | |||||
Description | Not Available | |||||
Synonyms |
|
|||||
Gene Name | XXYLT1 | |||||
Protein Type | Enzyme | |||||
Biological Properties | ||||||
General Function | Not Available | |||||
Specific Function | Alpha-1,3-xylosyltransferase, which elongates the O-linked xylose-glucose disaccharide attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of the second xylose. | |||||
GO Classification |
|
|||||
Cellular Location | Not Available | |||||
Pathways | Not Available | |||||
Gene Properties | ||||||
Chromosome Location | 3 | |||||
Locus | 3q29 | |||||
SNPs | Not Available | |||||
Gene Sequence | Not Available | |||||
Protein Properties | ||||||
Number of Residues | Not Available | |||||
Molecular Weight | 43806.33 | |||||
Theoretical pI | 8.134 | |||||
Pfam Domain Function | Not Available | |||||
Signals | Not Available | |||||
Transmembrane Regions | Not Available | |||||
Protein Sequence |
>gi|112181295|ref|NP_689744.3| xyloside xylosyltransferase 1 [Homo sapiens] MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARA GAPAAPSPPA |
|||||
External Links | ||||||
GenBank ID Protein | Not Available | |||||
UniProtKB/Swiss-Prot ID | Q8NBI6 | |||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||
PDB IDs | Not Available | |||||
GenBank Gene ID | Not Available | |||||
GeneCard ID | Not Available | |||||
GenAtlas ID | Not Available | |||||
HGNC ID | HGNC:26639 | |||||
References | ||||||
General References | Not Available |