| Identification |
|---|
| HMDB Protein ID
| CDBP05558 |
| Secondary Accession Numbers
| Not Available |
| Name
| Vacuolar protein sorting-associated protein 4B |
| Description
| Not Available |
| Synonyms
|
- Cell migration-inducing gene 1 protein
- Suppressor of K(+) transport growth defect 1
- Protein SKD1
|
| Gene Name
| VPS4B |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses).
|
| GO Classification
|
| Biological Process |
| endosome to lysosome transport via multivesicular body sorting pathway |
| intracellular cholesterol transport |
| endosome organization |
| potassium ion transport |
| cellular membrane organization |
| cell cycle |
| cell division |
| protein transport |
| response to lipid |
| Cellular Component |
| cytosol |
| vacuolar membrane |
| nucleus |
| early endosome |
| lysosome |
| late endosome |
| late endosome membrane |
| endosome membrane |
| Molecular Function |
| ATP binding |
| ATPase activity, coupled |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Endocytosis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 18 |
| Locus
| 18q21.33 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 49301.635 |
| Theoretical pI
| 7.22 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|17865802|ref|NP_004860.2| vacuolar protein sorting-associated protein 4B [Homo sapiens]
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRA
KCTEYLDRAE
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O75351 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:10895 |
| References |
|---|
| General References
| Not Available |