Identification
HMDB Protein ID CDBP05552
Secondary Accession Numbers Not Available
Name Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
Description Not Available
Synonyms
  1. Diphosphoinositol pentakisphosphate kinase 1
  2. Histidine acid phosphatase domain-containing protein 2A
  3. IP6 kinase
  4. Inositol pyrophosphate synthase 1
  5. InsP6 and PP-IP5 kinase 1
  6. VIP1 homolog
  7. hsVIP1
Gene Name PPIP5K1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Bifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP-InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2-InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer. Activated when cells are exposed to hyperosmotic stress.
GO Classification
Biological Process
inositol metabolic process
Cellular Component
cytosol
nucleus
Molecular Function
kinase activity
ATP binding
diphosphoinositol-pentakisphosphate kinase activity
inositol hexakisphosphate 1-kinase activity
inositol hexakisphosphate 3-kinase activity
inositol hexakisphosphate 5-kinase activity
inositol-1,3,4,5,6-pentakisphosphate kinase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 15
Locus 15q15.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 159519.82
Theoretical pI 5.399
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|195947359|ref|NP_001124330.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 isoform 5 [Homo sapiens]
MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGIC
AMTKKSKSKP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6PFW1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:29023
References
General References Not Available