| Identification |
|---|
| HMDB Protein ID
| CDBP05552 |
| Secondary Accession Numbers
| Not Available |
| Name
| Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 |
| Description
| Not Available |
| Synonyms
|
- Diphosphoinositol pentakisphosphate kinase 1
- Histidine acid phosphatase domain-containing protein 2A
- IP6 kinase
- Inositol pyrophosphate synthase 1
- InsP6 and PP-IP5 kinase 1
- VIP1 homolog
- hsVIP1
|
| Gene Name
| PPIP5K1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Bifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP-InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2-InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer. Activated when cells are exposed to hyperosmotic stress.
|
| GO Classification
|
| Biological Process |
| inositol metabolic process |
| Cellular Component |
| cytosol |
| nucleus |
| Molecular Function |
| inositol-1,3,4,5,6-pentakisphosphate kinase activity |
| kinase activity |
| ATP binding |
| diphosphoinositol-pentakisphosphate kinase activity |
| inositol hexakisphosphate 1-kinase activity |
| inositol hexakisphosphate 3-kinase activity |
| inositol hexakisphosphate 5-kinase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Inositol Phosphate Metabolism |    |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 15 |
| Locus
| 15q15.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 159519.82 |
| Theoretical pI
| 5.399 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|195947359|ref|NP_001124330.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 isoform 5 [Homo sapiens]
MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGIC
AMTKKSKSKP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6PFW1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:29023 |
| References |
|---|
| General References
| Not Available |