Showing Protein Ubiquitin-conjugating enzyme E2 Q1 (CDBP05542)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | CDBP05542 | |||||||||
| Secondary Accession Numbers | Not Available | |||||||||
| Name | Ubiquitin-conjugating enzyme E2 Q1 | |||||||||
| Description | Not Available | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | UBE2Q1 | |||||||||
| Protein Type | Enzyme | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). | |||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Pathways |
|
|||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 1 | |||||||||
| Locus | 1q21.3 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 46126.575 | |||||||||
| Theoretical pI | 5.091 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>gi|31543906|ref|NP_060052.3| ubiquitin-conjugating enzyme E2 Q1 [Homo sapiens] MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFR IASACLDELS |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q7Z7E8 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | ||||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:15698 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||
