Identification
HMDB Protein ID CDBP05536
Secondary Accession Numbers Not Available
Name Terminal uridylyltransferase 4
Description Not Available
Synonyms
  1. TUTase 4
  2. Zinc finger CCHC domain-containing protein 11
Gene Name ZCCHC11
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Uridylyltransferase that acts as a suppressor of microRNA (miRNA) biogenesis by specifically mediating the terminal uridylation of some miRNAs. Catalyzes the 3' uridylation of precursor let-7 (pre-let-7), a miRNA precursor. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 contributes to the maintenance of embryonic stem (ES) cells and is required for ES cells to maintain pluripotency. Does not bind RNA by itself, recruited to pre-let-7 miRNAs via its interaction with LIN28A and LIN28B. Also catalyzes the 3' uridylation of miR-26A, a miRNA that represses IL6 transcript, leading to abrogate IL6 transcript repression and promote cytokine expression. May also suppress Toll-like receptor-induced NF-kappa-B activity via binding to T2BP. Does not play a role in replication-dependent histone mRNA degradation.
GO Classification
Biological Process
RNA 3'-end processing
cytokine production
negative regulation of NF-kappaB transcription factor activity
stem cell maintenance
miRNA catabolic process
pre-miRNA processing
regulation of lipopolysaccharide-mediated signaling pathway
Cellular Component
cytoplasm
nucleolus
Molecular Function
nucleic acid binding
metal ion binding
RNA uridylyltransferase activity
zinc ion binding
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 1
Locus 1p32.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 185251.0
Theoretical pI 7.979
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|57863248|ref|NP_001009881.1| terminal uridylyltransferase 4 isoform a [Homo sapiens]
MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQ
NDICIEKTEV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q5TAX3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28981
References
General References Not Available