| Identification |
|---|
| HMDB Protein ID
| CDBP05530 |
| Secondary Accession Numbers
| Not Available |
| Name
| Fructose-2,6-bisphosphatase TIGAR |
| Description
| Not Available |
| Synonyms
|
- TP53-induced glycolysis and apoptosis regulator
|
| Gene Name
| TIGAR |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Fructose-bisphosphatase hydrolyzing fructose-2,6-bisphosphate as well as fructose-1,6-bisphosphate. Inhibits glycolysis by reducing cellular levels of fructose-2,6-bisphosphate. May protect cells against reactive oxygen species and against apoptosis induced by tp53.
|
| GO Classification
|
| Cellular Component |
| intracellular |
| Molecular Function |
| fructose-2,6-bisphosphate 2-phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Fructose and mannose metabolism | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12p13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 30062.295 |
| Theoretical pI
| 7.691 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|9966849|ref|NP_065108.1| fructose-2,6-bisphosphatase TIGAR [Homo sapiens]
MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLM
RTKQTMHGIL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NQ88 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:1185 |
| References |
|---|
| General References
| Not Available |