| Identification |
|---|
| HMDB Protein ID
| CDBP05527 |
| Secondary Accession Numbers
| Not Available |
| Name
| Trimethylguanosine synthase |
| Description
| Not Available |
| Synonyms
|
- CLL-associated antigen KW-2
- Cap-specific guanine-N2 methyltransferase
- Hepatocellular carcinoma-associated antigen 137
- Nuclear receptor coactivator 6-interacting protein
- PRIP-interacting protein with methyltransferase motif
- PIMT
- PIPMT
|
| Gene Name
| TGS1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation.
|
| GO Classification
|
| Biological Process |
| cellular lipid metabolic process |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| 7-methylguanosine RNA capping |
| ribonucleoprotein complex import into nucleus |
| small molecule metabolic process |
| ncRNA metabolic process |
| spliceosomal snRNP assembly |
| Cellular Component |
| cytosol |
| nucleoplasm |
| Cajal body |
| small nuclear ribonucleoprotein complex |
| Molecular Function |
| RNA trimethylguanosine synthase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA transport | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 8 |
| Locus
| 8q11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 96619.02 |
| Theoretical pI
| 4.948 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|151301096|ref|NP_079107.6| trimethylguanosine synthase [Homo sapiens]
MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQAT
EEEEGGYSCG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96RS0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17843 |
| References |
|---|
| General References
| Not Available |