Identification |
HMDB Protein ID
| CDBP05526 |
Secondary Accession Numbers
| Not Available |
Name
| Methylcytosine dioxygenase TET3 |
Description
| Not Available |
Synonyms
|
Not Available
|
Gene Name
| TET3 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in epigenetic chromatin reprogramming in the zygote following fertilization. Conversion into 5hmC initiates a process leading to cytosine demethylation through deamination into 5-hydroxymethyluracil (5hmU) and subsequent replacement by unmethylated cytosine by the base excision repair system. In zygotes, DNA demethylation occurs selectively in the paternal pronucleus before the first cell division, while the adjacent maternal pronucleus and certain paternally-imprinted loci are protected from this process. Participates in DNA demethylation in the paternal pronucleus by mediating conversion of 5mC into 5hmC. Does not mediate DNA demethylation of maternal pronucleus because of the presence of DPPA3/PGC7 on maternal chromatin that prevents TET3-binding to chromatin (By similarity).
|
GO Classification
|
Biological Process |
chromatin modification |
DNA demethylation |
DNA demethylation of male pronucleus |
Cellular Component |
cytoplasm |
male pronucleus |
Molecular Function |
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
metal ion binding |
methylcytosine dioxygenase activity |
|
Cellular Location
|
Not Available
|
Pathways
|
Not Available
|
Gene Properties |
Chromosome Location
| 2 |
Locus
| 2p13.1 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 179348.305 |
Theoretical pI
| 7.341 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|149944516|ref|NP_659430.1| methylcytosine dioxygenase TET3 [Homo sapiens]
MDSGPVYHGDSRQLSASGVPVNGAREPAGPSLLGTGGPWRVDQKPDWEAAPGPAHTARLE
DAHDLVAFSA
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| O43151 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:28313 |
References |
General References
| Not Available |