| Identification |
|---|
| HMDB Protein ID
| CDBP05524 |
| Secondary Accession Numbers
| Not Available |
| Name
| Methylcytosine dioxygenase TET1 |
| Description
| Not Available |
| Synonyms
|
- CXXC-type zinc finger protein 6
- Leukemia-associated protein with a CXXC domain
- Ten-eleven translocation 1 gene protein
|
| Gene Name
| TET1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC). Might initiate a process leading to cytosine demethylation through deamination into 5-hydroxymethyluracil (5hmU) and subsequent replacement by unmethylated cytosine by the base excision repair system. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. Preferentially binds to CpG-rich sequences at promoters of both transcriptionally active and polycomb-repressed genes. By controlling the levels of 5mC and 5hmC at gene promoters, it may regulate the gene expression silencing induced by cytosine methylation. May have a dual function by also repressing the expression of a subset of genes through recruitment of transcriptional repressors to promoters. Involved in the balance between pluripotency and lineage commitment of cells it plays a role in embryonic stem cells maintenance and inner cell mass cell specification.
|
| GO Classification
|
| Biological Process |
| negative regulation of methylation-dependent chromatin silencing |
| chromatin modification |
| DNA demethylation |
| transcription, DNA-dependent |
| inner cell mass cell differentiation |
| stem cell maintenance |
| Cellular Component |
| nucleus |
| Molecular Function |
| methylcytosine dioxygenase activity |
| oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
| iron ion binding |
| zinc ion binding |
| structure-specific DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | The oncogenic action of 2-hydroxyglutarate |    | Not Available | | The Oncogenic Action of Succinate |    | Not Available | | The Oncogenic Action of Fumarate |    | Not Available | | The oncogenic action of L-2-hydroxyglutarate in Hydroxygluaricaciduria |    | Not Available | | The oncogenic action of D-2-hydroxyglutarate in Hydroxygluaricaciduria |    | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 235306.965 |
| Theoretical pI
| 8.23 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|156139122|ref|NP_085128.2| methylcytosine dioxygenase TET1 [Homo sapiens]
MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKK
KTEPKPPVPV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8NFU7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:29484 |
| References |
|---|
| General References
| Not Available |