| Identification |
|---|
| HMDB Protein ID
| CDBP05523 |
| Secondary Accession Numbers
| Not Available |
| Name
| Transitional endoplasmic reticulum ATPase |
| Description
| Not Available |
| Synonyms
|
- TER ATPase
- 15S Mg(2+)-ATPase p97 subunit
- Valosin-containing protein
- VCP
|
| Gene Name
| VCP |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). Component of the VCP/p97-AMFR/gp78 complex that participates in the final step of the sterol-mediated ubiquitination and endoplasmic reticulum-associated degradation (ERAD) of HMGCR. Also involved in DNA damage response: recruited to double-strand breaks (DSBs) sites in a RNF8- and RNF168-dependent manner and promotes the recruitment of TP53BP1 at DNA damage sites. Recruited to stalled replication forks by SPRTN: may act by mediating extraction of DNA polymerase eta (POLH) to prevent excessive translesion DNA synthesis and limit the incidence of mutations induced by DNA damage.
|
| GO Classification
|
| Biological Process |
| double-strand break repair |
| protein N-linked glycosylation via asparagine |
| endoplasmic reticulum unfolded protein response |
| protein homooligomerization |
| translesion synthesis |
| ER-associated protein catabolic process |
| aggresome assembly |
| positive regulation of protein complex assembly |
| retrograde protein transport, ER to cytosol |
| protein ubiquitination |
| activation of cysteine-type endopeptidase activity involved in apoptotic process |
| positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| ER to Golgi vesicle-mediated transport |
| Cellular Component |
| cytosol |
| site of double-strand break |
| endoplasmic reticulum |
| nucleus |
| proteasome complex |
| Molecular Function |
| ATP binding |
| ATPase activity |
| polyubiquitin binding |
| lipid binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Protein processing in endoplasmic reticulum | Not Available |  | | Legionellosis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 9 |
| Locus
| 9p13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 89320.885 |
| Theoretical pI
| 5.267 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|6005942|ref|NP_009057.1| transitional endoplasmic reticulum ATPase [Homo sapiens]
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCI
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P55072 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:12666 |
| References |
|---|
| General References
| Not Available |