| Identification |
|---|
| HMDB Protein ID
| CDBP05521 |
| Secondary Accession Numbers
| Not Available |
| Name
| General transcription factor IIF subunit 2 |
| Description
| Not Available |
| Synonyms
|
- ATP-dependent helicase GTF2F2
- General transcription factor IIF 30 kDa subunit
- Transcription initiation factor IIF subunit beta
- Transcription initiation factor RAP30
- TFIIF-beta
|
| Gene Name
| GTF2F2 |
| Protein Type
| Transcription Factor |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.
|
| GO Classification
|
| Biological Process |
| 7-methylguanosine mRNA capping |
| mRNA splicing, via spliceosome |
| viral reproduction |
| positive regulation of transcription from RNA polymerase II promoter |
| positive regulation of viral transcription |
| transcription elongation from RNA polymerase II promoter |
| transcription initiation from RNA polymerase II promoter |
| Cellular Component |
| transcription factor TFIIF complex |
| microtubule cytoskeleton |
| nucleoplasm |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Basal transcription factors | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 13 |
| Locus
| 13q14 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 28380.13 |
| Theoretical pI
| 9.228 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4758488|ref|NP_004119.1| general transcription factor IIF subunit 2 [Homo sapiens]
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNE
DLANIHDIGG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P13984 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:4653 |
| References |
|---|
| General References
| Not Available |