| Identification |
|---|
| HMDB Protein ID
| CDBP05511 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-binding protein SMUBP-2 |
| Description
| Not Available |
| Synonyms
|
- ATP-dependent helicase IGHMBP2
- Glial factor 1
- Immunoglobulin mu-binding protein 2
- GF-1
|
| Gene Name
| IGHMBP2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Acts as a transcription regulator. Required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Binds to the insulin II gene RIPE3B enhancer region. May be involved in translation (By similarity). DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region. Preferentially binds to the 5'-GGGCT-3' motif. Interacts with tRNA-Tyr. Stimulates the transcription of the human neurotropic virus JCV.
|
| GO Classification
|
| Biological Process |
| protein homooligomerization |
| negative regulation of transcription from RNA polymerase II promoter |
| transcription, DNA-dependent |
| DNA recombination |
| cell death |
| translation |
| DNA repair |
| DNA replication |
| Cellular Component |
| growth cone |
| cytoplasm |
| nucleus |
| axon |
| ribonucleoprotein complex |
| Molecular Function |
| ATP-dependent 5'-3' DNA helicase activity |
| tRNA binding |
| ATP-dependent 5'-3' RNA helicase activity |
| ribosome binding |
| metal ion binding |
| ATP binding |
| single-stranded DNA binding |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11q13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 109148.07 |
| Theoretical pI
| 8.967 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|119392094|ref|NP_002171.2| DNA-binding protein SMUBP-2 [Homo sapiens]
MASAAVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLY
GRLLVTFEPR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P38935 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:5542 |
| References |
|---|
| General References
| Not Available |