Identification
HMDB Protein ID CDBP05507
Secondary Accession Numbers Not Available
Name Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Description Not Available
Synonyms
  1. GalNAc alpha-2,6-sialyltransferase III
  2. ST6GalNAc III
  3. STY
  4. Sialyltransferase 7C
  5. ST6GalNAcIII
  6. SIAT7-C
Gene Name ST6GALNAC3
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Involved in the biosynthesis of ganglioside GD1A from GM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAc residue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteins and glycolipids. ST6GalNAcIII prefers glycolipids to glycoproteins (By similarity).
GO Classification
Biological Process
glycosylceramide metabolic process
protein glycosylation
glycoprotein metabolic process
Cellular Component
integral to Golgi membrane
Molecular Function
sialyltransferase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 1
Locus 1p31.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 24021.865
Theoretical pI 9.252
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|229892275|ref|NP_001153483.1| alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 2 [Homo sapiens]
MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRT
HYGYINVKTQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8NDV1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:19343
References
General References Not Available