| Identification |
|---|
| HMDB Protein ID
| CDBP05504 |
| Secondary Accession Numbers
| Not Available |
| Name
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 |
| Description
| Not Available |
| Synonyms
|
- Alpha 2,3-ST 2
- Beta-galactoside alpha-2,3-sialyltransferase 2
- Gal-NAc6S
- Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
- ST3Gal II
- ST3GalA.2
- Sialyltransferase 4B
- ST3GalII
- SIAT4-B
|
| Gene Name
| ST3GAL2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found in terminal carbohydrate groups of certain glycoproteins, oligosaccharides and glycolipids. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.
|
| GO Classification
|
| Biological Process |
| amino sugar metabolic process |
| keratan sulfate biosynthetic process |
| O-glycan processing |
| post-translational protein modification |
| Cellular Component |
| Golgi cisterna membrane |
| integral to Golgi membrane |
| extracellular region |
| Golgi membrane |
| Molecular Function |
| beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | Mucin type O-Glycan biosynthesis | Not Available |  | | Glycosaminoglycan biosynthesis - keratan sulfate | Not Available |  | | Glycosphingolipid biosynthesis - globo series | Not Available |  | | Glycosphingolipid biosynthesis - ganglio series | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 16 |
| Locus
| 16q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 40172.565 |
| Theoretical pI
| 8.351 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|5902082|ref|NP_008858.1| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Homo sapiens]
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRL
SKERLSGKSC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q16842 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:10863 |
| References |
|---|
| General References
| Not Available |