Identification
HMDB Protein ID CDBP05500
Secondary Accession Numbers Not Available
Name Solute carrier family 52, riboflavin transporter, member 3
Description Not Available
Synonyms
  1. Riboflavin transporter 2
  2. hRFT2
Gene Name SLC52A3
Protein Type Transporter
Biological Properties
General Function Not Available
Specific Function Riboflavin transporter. Riboflavin transport is Na(+)-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin, flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD), and to a lesser extent by amiloride.
GO Classification
Biological Process
sensory perception of sound
cellular response to heat
Cellular Component
integral to plasma membrane
Molecular Function
riboflavin transporter activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 20
Locus 20p13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 50804.56
Theoretical pI 5.794
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|156564359|ref|NP_212134.3| solute carrier family 52, riboflavin transporter, member 3 [Homo sapiens]
MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTL
LHHFRPSCLS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQ40
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:16187
References
General References Not Available