| Identification |
|---|
| HMDB Protein ID
| CDBP05487 |
| Secondary Accession Numbers
| Not Available |
| Name
| Zinc transporter ZIP2 |
| Description
| Not Available |
| Synonyms
|
- 6A1
- Eti-1
- Solute carrier family 39 member 2
- Zrt- and Irt-like protein 2
- ZIP-2
- hZIP2
|
| Gene Name
| SLC39A2 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mediates zinc uptake. Zinc uptake may be mediated by a Zn(2+)-HCO(3)(-) symport mechanism and can function in the presence of albumin. May also transport other divalent cations. May be important in contact inhibition of normal epithelial cells and loss of its expression may play a role in tumorigenesis.
|
| GO Classification
|
| Cellular Component |
| integral to plasma membrane |
| cytoplasmic membrane-bounded vesicle |
| Molecular Function |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 14 |
| Locus
| 14q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 32742.03 |
| Theoretical pI
| 6.294 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|156415986|ref|NP_055394.2| zinc transporter ZIP2 isoform a [Homo sapiens]
MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAG
FMHMTAEALE
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NP94 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17127 |
| References |
|---|
| General References
| Not Available |