| Identification |
|---|
| HMDB Protein ID
| CDBP05483 |
| Secondary Accession Numbers
| Not Available |
| Name
| Sulfate anion transporter 1 |
| Description
| Not Available |
| Synonyms
|
- SAT-1
- Solute carrier family 26 member 1
|
| Gene Name
| SLC26A1 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| High affinity uptake of sulfate. Accepts oxalate, but not succinate as a cosubstrate.
|
| GO Classification
|
| Biological Process |
| sulfate transport |
| Cellular Component |
| plasma membrane |
| integral to membrane |
| Molecular Function |
| chloride transmembrane transporter activity |
| oxalate transmembrane transporter activity |
| sulfate transmembrane transporter activity |
| secondary active sulfate transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4p16.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 75014.72 |
| Theoretical pI
| 8.104 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|20336272|ref|NP_071325.2| sulfate anion transporter 1 isoform a [Homo sapiens]
MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWL
RQYRPREYLA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H2B4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:10993 |
| References |
|---|
| General References
| Not Available |