| Identification |
|---|
| HMDB Protein ID
| CDBP05480 |
| Secondary Accession Numbers
| Not Available |
| Name
| Regulator of telomere elongation helicase 1 |
| Description
| Not Available |
| Synonyms
|
- Novel helicase-like
|
| Gene Name
| RTEL1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| ATP-dependent DNA helicase required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. Antagonizes homologous recombination by promoting the disassembly of D loop recombination intermediates. Also required to regulate telomere length; probably due to its anti-recombinase function.
|
| GO Classification
|
| Biological Process |
| DNA repair |
| telomere maintenance |
| regulation of double-strand break repair via homologous recombination |
| Cellular Component |
| nucleus |
| Molecular Function |
| metal ion binding |
| ATP binding |
| 4 iron, 4 sulfur cluster binding |
| ATP-dependent DNA helicase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 20 |
| Locus
| 20q13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 133681.63 |
| Theoretical pI
| 8.298 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|7706541|ref|NP_057518.1| regulator of telomere elongation helicase 1 isoform 1 [Homo sapiens]
MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWR
EHLRDGISAR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NZ71 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15888 |
| References |
|---|
| General References
| Not Available |