| Identification |
|---|
| HMDB Protein ID
| CDBP05475 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-directed RNA polymerase II subunit RPB9 |
| Description
| Not Available |
| Synonyms
|
- RNA polymerase II subunit B9
- DNA-directed RNA polymerase II subunit I
- RNA polymerase II 14.5 kDa subunit
- RPB14.5
|
| Gene Name
| POLR2I |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB9 is part of the upper jaw surrounding the central large cleft and thought to grab the incoming DNA template (By similarity).
|
| GO Classification
|
| Biological Process |
| positive regulation of viral transcription |
| transcription elongation from RNA polymerase II promoter |
| transcription initiation from RNA polymerase II promoter |
| transcription-coupled nucleotide-excision repair |
| 7-methylguanosine mRNA capping |
| mRNA splicing, via spliceosome |
| viral reproduction |
| protein phosphorylation |
| Cellular Component |
| DNA-directed RNA polymerase II, core complex |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| DNA-directed RNA polymerase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA polymerase | Not Available |  | | Huntington's disease | Not Available |  | | Epstein-Barr virus infection | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19q12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 14523.1 |
| Theoretical pI
| 5.138 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|5453930|ref|NP_006224.1| DNA-directed RNA polymerase II subunit RPB9 [Homo sapiens]
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P36954 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9196 |
| References |
|---|
| General References
| Not Available |