| Identification |
|---|
| HMDB Protein ID
| CDBP05473 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-directed RNA polymerase II subunit RPB4 |
| Description
| Not Available |
| Synonyms
|
- RNA polymerase II subunit B4
- DNA-directed RNA polymerase II subunit D
- RNA polymerase II 16 kDa subunit
- RPB16
|
| Gene Name
| POLR2D |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA (By similarity).
|
| GO Classification
|
| Biological Process |
| 7-methylguanosine mRNA capping |
| mRNA splicing, via spliceosome |
| viral reproduction |
| protein phosphorylation |
| positive regulation of viral transcription |
| transcription elongation from RNA polymerase II promoter |
| transcription initiation from RNA polymerase II promoter |
| transcription-coupled nucleotide-excision repair |
| Cellular Component |
| DNA-directed RNA polymerase II, core complex |
| Molecular Function |
| DNA-directed RNA polymerase activity |
| nucleotide binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA polymerase | Not Available |  | | Huntington's disease | Not Available |  | | Epstein-Barr virus infection | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 16311.105 |
| Theoretical pI
| 4.795 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4758574|ref|NP_004796.1| DNA-directed RNA polymerase II subunit RPB4 [Homo sapiens]
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTAR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O15514 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9191 |
| References |
|---|
| General References
| Not Available |