Identification
HMDB Protein ID CDBP05472
Secondary Accession Numbers Not Available
Name DNA-directed RNA polymerase II subunit RPB3
Description Not Available
Synonyms
  1. RNA polymerase II subunit 3
  2. RNA polymerase II subunit B3
  3. DNA-directed RNA polymerase II 33 kDa polypeptide
  4. DNA-directed RNA polymerase II subunit C
  5. RPB31
  6. RPB33
Gene Name POLR2C
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB3 is part of the core element with the central large cleft and the clamp element that moves to open and close the cleft (By similarity).
GO Classification
Biological Process
transcription-coupled nucleotide-excision repair
7-methylguanosine mRNA capping
mRNA splicing, via spliceosome
viral reproduction
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
Cellular Component
DNA-directed RNA polymerase II, core complex
microtubule cytoskeleton
cytoplasm
Molecular Function
DNA binding
DNA-directed RNA polymerase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 16
Locus 16q13-q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 31440.86
Theoretical pI 4.92
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|14702171|ref|NP_116558.1| DNA-directed RNA polymerase II subunit RPB3 [Homo sapiens]
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P19387
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9189
References
General References Not Available