| Identification |
|---|
| HMDB Protein ID
| CDBP05471 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-directed RNA polymerase II subunit RPB11-b1 |
| Description
| Not Available |
| Synonyms
|
- RNA polymerase II subunit B11-b1
- RPB11b1
- DNA-directed RNA polymerase II subunit J2
|
| Gene Name
| POLR2J2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft (By similarity).
|
| GO Classification
|
| Biological Process |
| transcription, DNA-dependent |
| Cellular Component |
| nucleus |
| Molecular Function |
| DNA-directed RNA polymerase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA polymerase | Not Available |  | | Huntington's disease | Not Available |  | | Epstein-Barr virus infection | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 7 |
| Locus
| 7q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 13074.07 |
| Theoretical pI
| 6.291 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|332634984|ref|NP_001091084.2| DNA-directed RNA polymerase II subunit RPB11-b2 [Homo sapiens]
MNAPPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKI
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9GZM3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:23208 |
| References |
|---|
| General References
| Not Available |