| Identification |
|---|
| HMDB Protein ID
| CDBP05466 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-directed RNA polymerases I, II, and III subunit RPABC4 |
| Description
| Not Available |
| Synonyms
|
- RNA polymerases I, II, and III subunit ABC4
- ABC10-alpha
- DNA-directed RNA polymerase II subunit K
- RNA polymerase II 7.0 kDa subunit
- RPB10alpha
- RPB7.0
|
| Gene Name
| POLR2K |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
|
| GO Classification
|
| Biological Process |
| transcription elongation from RNA polymerase II promoter |
| transcription initiation from RNA polymerase II promoter |
| termination of RNA polymerase III transcription |
| transcription elongation from RNA polymerase III promoter |
| regulation of transcription from RNA polymerase I promoter |
| transcription-coupled nucleotide-excision repair |
| 7-methylguanosine mRNA capping |
| mRNA splicing, via spliceosome |
| termination of RNA polymerase I transcription |
| transcription elongation from RNA polymerase I promoter |
| transcription initiation from RNA polymerase I promoter |
| viral reproduction |
| positive regulation of viral transcription |
| Cellular Component |
| nucleoplasm |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| DNA-directed RNA polymerase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA polymerase | Not Available |  | | Cytosolic DNA-sensing pathway | Not Available |  | | Huntington's disease | Not Available |  | | Epstein-Barr virus infection | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 8 |
| Locus
| 8q22.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 7004.145 |
| Theoretical pI
| 9.063 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4826924|ref|NP_005025.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Homo sapiens]
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P53803 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9198 |
| References |
|---|
| General References
| Not Available |