| Identification |
|---|
| HMDB Protein ID
| CDBP05450 |
| Secondary Accession Numbers
| Not Available |
| Name
| Histone-lysine N-methyltransferase PRDM9 |
| Description
| Not Available |
| Synonyms
|
- PR domain zinc finger protein 9
- PR domain-containing protein 9
|
| Gene Name
| PRDM9 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Histone methyltransferase that specifically trimethylates 'Lys-4' of histone H3 during meiotic prophase and is essential for proper meiotic progression. Does not have the ability to mono- and dimethylate 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes during early meiotic prophase (By similarity).
|
| GO Classification
|
| Biological Process |
| histone lysine methylation |
| meiotic gene conversion |
| positive regulation of reciprocal meiotic recombination |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| Cellular Component |
| chromosome |
| nucleoplasm |
| Molecular Function |
| nucleic acid binding |
| histone-lysine N-methyltransferase activity |
| metal ion binding |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5p14 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 103375.975 |
| Theoretical pI
| 9.191 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|147905620|ref|NP_064612.2| histone-lysine N-methyltransferase PRDM9 [Homo sapiens]
MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNA
LITIGLRATR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NQV7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13994 |
| References |
|---|
| General References
| Not Available |