| Identification |
|---|
| HMDB Protein ID
| CDBP05448 |
| Secondary Accession Numbers
| Not Available |
| Name
| Putative histone-lysine N-methyltransferase PRDM6 |
| Description
| Not Available |
| Synonyms
|
- PR domain zinc finger protein 6
- PR domain-containing protein 6
|
| Gene Name
| PRDM6 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Putative histone methyltransferase that acts as a transcriptional repressor of smooth muscle gene expression. Promotes the transition from differentiated to proliferative smooth muscle by suppressing differentiation and maintaining the proliferative potential of vascular smooth muscle cells. Also plays a role in endothelial cells by inhibiting endothelial cell proliferation, survival and differentiation. It is unclear whether it has histone methyltransferase activity in vivo. According to some authors, it does not act as a histone methyltransferase by itself and represses transcription by recruiting EHMT2/G9a. According to others, it possesses histone methyltransferase activity when associated with other proteins and specifically methylates 'Lys-20' of histone H4 in vitro. 'Lys-20' methylation represents a specific tag for epigenetic transcriptional repression (By similarity).
|
| GO Classification
|
| Biological Process |
| histone lysine methylation |
| negative regulation of smooth muscle cell differentiation |
| neurogenesis |
| negative regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| Cellular Component |
| nucleus |
| Molecular Function |
| nucleic acid binding |
| histone-lysine N-methyltransferase activity |
| metal ion binding |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q23.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 64451.23 |
| Theoretical pI
| 7.699 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|210031233|ref|NP_001129711.1| putative histone-lysine N-methyltransferase PRDM6 [Homo sapiens]
MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGAGPLKGSGAAGLLSAPQPLQPPPPPPPPE
RAEPPPDSLR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NQX0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9350 |
| References |
|---|
| General References
| Not Available |