| Identification |
|---|
| HMDB Protein ID
| CDBP05425 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA polymerase sigma |
| Description
| Not Available |
| Synonyms
|
- DNA polymerase kappa
- LAK-1
- PAP-associated domain-containing protein 7
- Terminal uridylyltransferase 5
- Topoisomerase-related function protein 4-1
- TUTase 5
- TRF4-1
|
| Gene Name
| PAPD7 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA polymerase, probably involved in DNA repair. May play a role in sister chromatid cohesion. Does not play a role in replication-dependent histone mRNA degradation.
|
| GO Classification
|
| Biological Process |
| cell division |
| sister chromatid cohesion |
| DNA replication |
| double-strand break repair |
| response to drug |
| mitotic chromosome condensation |
| Cellular Component |
| nucleus |
| Molecular Function |
| DNA binding |
| metal ion binding |
| DNA-directed DNA polymerase activity |
| SMC family protein binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA degradation | Not Available |  | | Nucleotide Excision Repair |    | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5p15 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 59745.09 |
| Theoretical pI
| 9.39 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|284507293|ref|NP_001165276.1| DNA polymerase sigma isoform 2 [Homo sapiens]
MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPP
LQLLEQALRK
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5XG87 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16705 |
| References |
|---|
| General References
| Not Available |