| Identification |
|---|
| HMDB Protein ID
| CDBP05416 |
| Secondary Accession Numbers
| Not Available |
| Name
| Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 |
| Description
| Not Available |
| Synonyms
|
- 60S ribosomal protein L8 histidine hydroxylase
- Histone lysine demethylase NO66
- Myc-associated protein with JmjC domain
- Nucleolar protein 66
- Ribosomal oxygenase NO66
- hsNO66
- ROX
|
| Gene Name
| NO66 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Specifically demethylates 'Lys-4' (H3K4me) and 'Lys-36' (H3K36me) of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' (H3K4me3) and monomethylated H3 'Lys-4' (H3K4me1) residues, while it has weaker activity for dimethylated H3 'Lys-36' (H3K36me2). Also catalyzes the hydroxylation of 60S ribosomal protein L8 on 'His-216'. Acts as a regulator of osteoblast differentiation via its interaction with SP7/OSX by demethylating H3K4me and H3K36me, thereby inhibiting SP7/OSX-mediated promoter activation (By similarity). May also play a role in ribosome biogenesis and in the replication or remodeling of certain heterochromatic region. Participates in MYC-induced transcriptional activation.
|
| GO Classification
|
| Biological Process |
| negative regulation of transcription, DNA-dependent |
| negative regulation of osteoblast differentiation |
| transcription, DNA-dependent |
| Cellular Component |
| nucleolus |
| nucleus |
| nucleoplasm |
| Molecular Function |
| iron ion binding |
| histone demethylase activity (H3-K4 specific) |
| histone demethylase activity (H3-K36 specific) |
| oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 14 |
| Locus
| 14q24.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 71084.97 |
| Theoretical pI
| 6.455 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|106879206|ref|NP_078920.2| bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 [Homo sapiens]
MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPS
ENSEESRVES
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H6W3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20968 |
| References |
|---|
| General References
| Not Available |