| Identification |
|---|
| HMDB Protein ID
| CDBP05410 |
| Secondary Accession Numbers
| Not Available |
| Name
| Magnesium transporter NIPA1 |
| Description
| Not Available |
| Synonyms
|
- Non-imprinted in Prader-Willi/Angelman syndrome region protein 1
- Spastic paraplegia 6 protein
|
| Gene Name
| NIPA1 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity).
|
| GO Classification
|
| Biological Process |
| cell death |
| Cellular Component |
| plasma membrane |
| early endosome |
| integral to membrane |
| Molecular Function |
| magnesium ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 15 |
| Locus
| 15q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 27309.285 |
| Theoretical pI
| 7.168 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|214010179|ref|NP_001135747.1| magnesium transporter NIPA1 isoform 2 [Homo sapiens]
MAVGQIGNFLAYTAVPTVLVTPLGALGVPFGSILASYLLKEKLNILGKLGCLLSCAGSVV
LIIHSPKSES
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q7RTP0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17043 |
| References |
|---|
| General References
| Not Available |