| Identification |
|---|
| HMDB Protein ID
| CDBP05405 |
| Secondary Accession Numbers
| Not Available |
| Name
| Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 |
| Description
| Not Available |
| Synonyms
|
- Glucosaminyl N-deacetylase/N-sulfotransferase 1
- N-heparan sulfate sulfotransferase 1
- [Heparan sulfate]-glucosamine N-sulfotransferase 1
- NDST-1
- N-HSST 1
- HSNST 1
|
| Gene Name
| NDST1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response.
|
| GO Classification
|
| Biological Process |
| heparin biosynthetic process |
| embryonic neurocranium morphogenesis |
| polysaccharide biosynthetic process |
| smoothened signaling pathway |
| MAPK cascade |
| embryonic viscerocranium morphogenesis |
| midbrain development |
| carbohydrate metabolic process |
| forebrain development |
| fibroblast growth factor receptor signaling pathway |
| heparan sulfate proteoglycan biosynthetic process |
| glycosaminoglycan biosynthetic process |
| inflammatory response |
| respiratory gaseous exchange |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| deacetylase activity |
| [heparan sulfate]-glucosamine N-sulfotransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | heparan sulfate biosynthesis | Not Available | Not Available | | heparin biosynthesis | Not Available | Not Available | | Glycosaminoglycan biosynthesis - heparan sulfate / heparin | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q33.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 100867.015 |
| Theoretical pI
| 7.978 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4505351|ref|NP_001534.1| bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 [Homo sapiens]
MPALACLRRLCRHVSPQAVLFLLFIFCLFSVFISAYYLYGWKRGLEPSADAPEPDCGDPP
PVAPSRLLPL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P52848 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:7680 |
| References |
|---|
| General References
| Not Available |