| Identification |
|---|
| HMDB Protein ID
| CDBP05403 |
| Secondary Accession Numbers
| Not Available |
| Name
| Bifunctional protein NCOAT |
| Description
| Not Available |
| Synonyms
|
- Meningioma-expressed antigen 5
- Nuclear cytoplasmic O-GlcNAcase and acetyltransferase
|
| Gene Name
| MGEA5 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Possesses hyaluronidase activity. Acetylates 'Lys-8' of histone H4 and 'Lys-14' of histone H3 (By similarity).
|
| GO Classification
|
| Biological Process |
| positive regulation of DNA metabolic process |
| positive regulation of glucose import |
| positive regulation of growth hormone secretion |
| positive regulation of protein complex disassembly |
| response to steroid hormone stimulus |
| N-acetylglucosamine metabolic process |
| positive regulation of calcium ion transport into cytosol |
| aging |
| positive regulation of insulin secretion |
| protein targeting to membrane |
| positive regulation of cell killing |
| positive regulation of mitochondrial depolarization |
| positive regulation of proteolysis |
| dATP metabolic process |
| glycoprotein catabolic process |
| necrotic cell death |
| negative regulation of cardiac muscle adaptation |
| negative regulation of protein glycosylation |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| hyalurononglucosaminidase activity |
| histone acetyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q24.1-q24.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 96930.75 |
| Theoretical pI
| 5.025 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|215490056|ref|NP_001135906.1| bifunctional protein NCOAT isoform b [Homo sapiens]
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O60502 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:7056 |
| References |
|---|
| General References
| Not Available |