| Identification |
|---|
| HMDB Protein ID
| CDBP05400 |
| Secondary Accession Numbers
| Not Available |
| Name
| NAD kinase domain-containing protein 1, mitochondrial |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| NADKD1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mitochondrial NAD(+) kinase that phosphorylates NAD(+) to yield NADP(+). Can use both ATP or inorganic polyphosphate as the phosphoryl donor. Also has weak NADH kinase activity in vitro; however NADH kinase activity is much weaker than the NAD(+) kinase activity and may not be relevant in vivo.
|
| GO Classification
|
| Biological Process |
| NAD metabolic process |
| NADP biosynthetic process |
| Cellular Component |
| mitochondrion |
| Molecular Function |
| NAD+ kinase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5p13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 49432.465 |
| Theoretical pI
| 8.171 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|146134341|ref|NP_001078880.1| NAD kinase domain-containing protein 1, mitochondrial isoform 1 [Homo sapiens]
MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGS
RADGGFRPSR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q4G0N4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26404 |
| References |
|---|
| General References
| Not Available |