Showing Protein NAD kinase domain-containing protein 1, mitochondrial (CDBP05400)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 4 compounds
Identification
HMDB Protein ID CDBP05400
Secondary Accession Numbers Not Available
Name NAD kinase domain-containing protein 1, mitochondrial
Description Not Available
Synonyms Not Available
Gene Name NADKD1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Mitochondrial NAD(+) kinase that phosphorylates NAD(+) to yield NADP(+). Can use both ATP or inorganic polyphosphate as the phosphoryl donor. Also has weak NADH kinase activity in vitro; however NADH kinase activity is much weaker than the NAD(+) kinase activity and may not be relevant in vivo.
GO Classification
Biological Process
NAD metabolic process
NADP biosynthetic process
Cellular Component
mitochondrion
Molecular Function
NAD+ kinase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 5
Locus 5p13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 49432.465
Theoretical pI 8.171
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>gi|146134341|ref|NP_001078880.1| NAD kinase domain-containing protein 1, mitochondrial isoform 1 [Homo sapiens]
MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGS
RADGGFRPSR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q4G0N4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26404
References
General References Not Available