| Identification |
|---|
| HMDB Protein ID
| CDBP05395 |
| Secondary Accession Numbers
| Not Available |
| Name
| N-alpha-acetyltransferase 10 |
| Description
| Not Available |
| Synonyms
|
- N-terminal acetyltransferase complex ARD1 subunit homolog A
- NatA catalytic subunit
|
| Gene Name
| NAA10 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration.
|
| GO Classification
|
| Biological Process |
| DNA packaging |
| N-terminal protein amino acid acetylation |
| internal protein amino acid acetylation |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| N-acetyltransferase activity |
| peptide alpha-N-acetyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| X |
| Locus
| Xq28 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 26458.27 |
| Theoretical pI
| 5.643 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|10835057|ref|NP_003482.1| N-alpha-acetyltransferase 10 isoform 1 [Homo sapiens]
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM
EEDPDDVPHG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P41227 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18704 |
| References |
|---|
| General References
| Not Available |