| Identification |
|---|
| HMDB Protein ID
| CDBP05384 |
| Secondary Accession Numbers
| Not Available |
| Name
| Putative helicase MOV-10 |
| Description
| Not Available |
| Synonyms
|
- Moloney leukemia virus 10 protein
|
| Gene Name
| MOV10 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Probable RNA helicase. Required for RNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. Also required for RNA-directed transcription and replication of the human hepatitis delta virus (HDV). Interacts with small capped HDV RNAs derived from genomic hairpin structures that mark the initiation sites of RNA-dependent HDV RNA transcription.
|
| GO Classification
|
| Biological Process |
| mRNA cleavage involved in gene silencing by miRNA |
| Notch signaling pathway |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| Cellular Component |
| cytosol |
| cytoplasmic mRNA processing body |
| Molecular Function |
| ATP binding |
| RNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1p13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 113670.24 |
| Theoretical pI
| 8.815 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|194272168|ref|NP_001123551.1| putative helicase MOV-10 [Homo sapiens]
MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYG
MKIANLAYVT
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9HCE1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:7200 |
| References |
|---|
| General References
| Not Available |