| Identification |
|---|
| HMDB Protein ID
| CDBP05373 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA helicase MCM9 |
| Description
| Not Available |
| Synonyms
|
- hMCM9
- Mini-chromosome maintenance deficient domain-containing protein 1
- Minichromosome maintenance 9
|
| Gene Name
| MCM9 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart.
|
| GO Classification
|
| Biological Process |
| DNA replication |
| double-strand break repair via homologous recombination |
| female gamete generation |
| Cellular Component |
| nucleus |
| MCM8-MCM9 complex |
| Molecular Function |
| ATP binding |
| DNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| 6q22.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 127311.57 |
| Theoretical pI
| 7.732 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|312284070|ref|NP_060166.2| DNA helicase MCM9 isoform 1 [Homo sapiens]
MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNM
FPSEVLTIFD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NXL9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21484 |
| References |
|---|
| General References
| Not Available |