| Identification |
|---|
| HMDB Protein ID
| CDBP05367 |
| Secondary Accession Numbers
| Not Available |
| Name
| Lysophospholipid acyltransferase 7 |
| Description
| Not Available |
| Synonyms
|
- LPLAT 7
- 1-acylglycerophosphatidylinositol O-acyltransferase
- Bladder and breast carcinoma-overexpressed gene 1 protein
- Leukocyte receptor cluster member 4
- Lysophosphatidylinositol acyltransferase
- Membrane-bound O-acyltransferase domain-containing protein 7
- LPIAT
- Lyso-PI acyltransferase
- O-acyltransferase domain-containing protein 7
- h-mboa-7
|
| Gene Name
| MBOAT7 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Acyltransferase which mediates the conversion of lysophosphatidylinositol (1-acylglycerophosphatidylinositol or LPI) into phosphatidylinositol (1,2-diacyl-sn-glycero-3-phosphoinositol or PI) (LPIAT activity). Prefers arachidonoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
|
| GO Classification
|
| Biological Process |
| glycerophospholipid biosynthetic process |
| small molecule metabolic process |
| phosphatidylinositol acyl-chain remodeling |
| Cellular Component |
| endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| transferase activity, transferring acyl groups other than amino-acyl groups |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | phospholipid metabolism | Not Available | Not Available | | Glycerophospholipid metabolism | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19q13.4 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 44732.46 |
| Theoretical pI
| 8.863 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|225703081|ref|NP_001139528.1| lysophospholipid acyltransferase 7 isoform 2 [Homo sapiens]
MGSSRCGPGAHPVHLWPPHFAFSGHHPRDLGPHSGPALLVSLASEVQDLHLAQRKEMASG
FSKGPTLGLL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96N66 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15505 |
| References |
|---|
| General References
| Not Available |