| Identification |
|---|
| HMDB Protein ID
| CDBP05366 |
| Secondary Accession Numbers
| Not Available |
| Name
| Lysophospholipid acyltransferase 2 |
| Description
| Not Available |
| Synonyms
|
- LPLAT 2
- 1-acylglycerophosphate O-acyltransferase
- 1-acylglycerophosphoethanolamine O-acyltransferase
- Lysophosphatidic acid acyltransferase
- Lysophosphatidylethanolamine acyltransferase
- Membrane-bound O-acyltransferase domain-containing protein 2
- LPAAT
- Lyso-PA acyltransferase
- LPEAT
- Lyso-PE acyltransferase
- O-acyltransferase domain-containing protein 2
|
| Gene Name
| MBOAT2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Acyltransferase which mediates the conversion of lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidic acid (LPA) into phosphatidic acid (PA) (LPAAT activity). Has also a very weak lysophosphatidylcholine acyltransferase (LPCAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
|
| GO Classification
|
| Biological Process |
| glycerophospholipid biosynthetic process |
| phosphatidylcholine acyl-chain remodeling |
| phosphatidylethanolamine acyl-chain remodeling |
| Cellular Component |
| endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| 1-acylglycerol-3-phosphate O-acyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | phospholipid metabolism | Not Available | Not Available | | Glycerophospholipid metabolism | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2p25.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 59526.225 |
| Theoretical pI
| 8.036 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|40548387|ref|NP_620154.2| lysophospholipid acyltransferase 2 [Homo sapiens]
MATTSTTGSTLLQPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVA
TLLGLYLALF
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6ZWT7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25193 |
| References |
|---|
| General References
| Not Available |