| Identification |
|---|
| HMDB Protein ID
| CDBP05344 |
| Secondary Accession Numbers
| Not Available |
| Name
| Peptidyl-tRNA hydrolase ICT1, mitochondrial |
| Description
| Not Available |
| Synonyms
|
- Digestion substraction 1
- Immature colon carcinoma transcript 1 protein
- DS-1
|
| Gene Name
| ICT1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
|
| GO Classification
|
| Biological Process |
| mitochondrial translational termination |
| Cellular Component |
| mitochondrial large ribosomal subunit |
| Molecular Function |
| aminoacyl-tRNA hydrolase activity |
| translation release factor activity, codon nonspecific |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q25.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 23629.855 |
| Theoretical pI
| 10.074 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4557657|ref|NP_001536.1| peptidyl-tRNA hydrolase ICT1, mitochondrial precursor [Homo sapiens]
MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWR
VPNGAKQADS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q14197 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:5359 |
| References |
|---|
| General References
| Not Available |