Identification
HMDB Protein ID CDBP05339
Secondary Accession Numbers Not Available
Name HRAS-like suppressor 3
Description Not Available
Synonyms
  1. HRSL3
  2. Adipose-specific phospholipase A2
  3. Group XVI phospholipase A1/A2
  4. H-rev 107 protein homolog
  5. HRAS-like suppressor 1
  6. HREV107-1
  7. HREV107-3
  8. Renal carcinoma antigen NY-REN-65
  9. AdPLA
Gene Name PLA2G16
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Specifically catalyzes the release of fatty acids from phospholipids in adipose tissue (By similarity). N- and O-acylation activity is hardly detectable. Might decrease protein phosphatase 2A (PP2A) activity.
GO Classification
Biological Process
phosphatidylinositol acyl-chain remodeling
phosphatidylserine acyl-chain remodeling
lipid catabolic process
glycerophospholipid biosynthetic process
negative regulation of cell cycle
phosphatidylcholine acyl-chain remodeling
phosphatidylethanolamine acyl-chain remodeling
Cellular Component
cytosol
endoplasmic reticulum
perinuclear region of cytoplasm
integral to membrane
Molecular Function
1-acyl-2-lysophosphatidylserine acylhydrolase activity
phosphatidylcholine 1-acylhydrolase activity
phosphatidylserine 1-acylhydrolase activity
phospholipase A2 activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 11
Locus 11q12.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 17936.515
Theoretical pI 7.98
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|189571621|ref|NP_001121675.1| HRAS-like suppressor 3 [Homo sapiens]
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV
KKELLYDVAG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P53816
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17825
References
General References Not Available